SCOPe 2.07: Domain d1y2ib1: 1y2i B:1-107

Lineage for d1y2ib1 (1y2i B:1-107)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.5: YbjQ-like [117782] (2 families)
   pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly

5. Family d.230.5.1: YbjQ-like [117783] (3 proteins)
   Pfam PF01906; DUF 74, UPF0145

6. Protein Hypothetical protein YbjQ [117784] (1 species)

7. Species Shigella flexneri [TaxId:623] [117785] (1 PDB entry)
   Uniprot Q83LS2

8. Domain d1y2ib1: 1y2i B:1-107 [116402]
   Other proteins in same PDB: d1y2ia2, d1y2ib2, d1y2ic2, d1y2id2, d1y2ie2
   Structural genomics target

Details for d1y2ib1

PDB Entry: 1y2i, 2.3 Å

PDB Description: crystal structure of mcsg target apc27401 from shigella flexneri

PDB Compounds: (B:) Hypothetical Protein S0862

SCOPe Domain Sequences for d1y2ib1:

Sequence; same for both SEQRES and ATOM records:

>d1y2ib1 d.230.5.1 (B:1-107) Hypothetical protein YbjQ {Shigella flexneri [TaxId: 623]}
mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrr

Timeline for d1y2ib1:

• d1y2ib1 first appeared in SCOP 1.71, called d1y2ib_
  
• d1y2ib1 appears in SCOPe 2.06
  
• d1y2ib1 appears in the current release, SCOPe 2.08