| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.5: YbjQ-like [117782] (2 families) ![]() pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
| Family d.230.5.1: YbjQ-like [117783] (3 proteins) Pfam PF01906; DUF 74, UPF0145 |
| Protein Hypothetical protein YbjQ [117784] (1 species) |
| Species Shigella flexneri [TaxId:623] [117785] (1 PDB entry) Uniprot Q83LS2 |
| Domain d1y2ib1: 1y2i B:1-107 [116402] Other proteins in same PDB: d1y2ia2, d1y2ib2, d1y2ic2, d1y2id2, d1y2ie2 Structural genomics target |
PDB Entry: 1y2i (more details), 2.3 Å
SCOPe Domain Sequences for d1y2ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2ib1 d.230.5.1 (B:1-107) Hypothetical protein YbjQ {Shigella flexneri [TaxId: 623]}
mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrr
Timeline for d1y2ib1: