Lineage for d1y28a_ (1y28 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210819Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2210832Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 2210833Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries)
    Uniprot P23222 152-270
  8. 2210854Domain d1y28a_: 1y28 A: [116399]
    complexed with hem

Details for d1y28a_

PDB Entry: 1y28 (more details), 2.1 Å

PDB Description: crystal structure of the r220a metbjfixl heme domain
PDB Compounds: (A:) sensor protein fixl

SCOPe Domain Sequences for d1y28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y28a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
dphiigigaivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq

SCOPe Domain Coordinates for d1y28a_:

Click to download the PDB-style file with coordinates for d1y28a_.
(The format of our PDB-style files is described here.)

Timeline for d1y28a_: