Lineage for d1y23d_ (1y23 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598122Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 598123Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 598124Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (6 proteins)
    Pfam 01230
    topologically similar to the N-terminal domain of protein kinases
  6. 598142Protein Hit [117789] (1 species)
  7. 598143Species Bacillus subtilis [TaxId:1423] [117790] (1 PDB entry)
  8. 598147Domain d1y23d_: 1y23 D: [116397]

Details for d1y23d_

PDB Entry: 1y23 (more details), 2.3 Å

PDB Description: crystal structure of a member of hit family of proteins from bacillus subtilis

SCOP Domain Sequences for d1y23d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y23d_ d.13.1.1 (D:) Hit {Bacillus subtilis}
encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
dykpedlqnisssiakrla

SCOP Domain Coordinates for d1y23d_:

Click to download the PDB-style file with coordinates for d1y23d_.
(The format of our PDB-style files is described here.)

Timeline for d1y23d_: