SCOPe 2.05: Domain d1y23c_: 1y23 C:

Lineage for d1y23c_ (1y23 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Hit [117789] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117790] (1 PDB entry)
   Uniprot O07513

8. Domain d1y23c_: 1y23 C: [116396]
   Structural genomics target
   complexed with mg, zn

Details for d1y23c_

PDB Entry: 1y23, 2.3 Å

PDB Description: crystal structure of a member of hit family of proteins from bacillus subtilis

PDB Compounds: (C:) Histidine triad protein

SCOPe Domain Sequences for d1y23c_:

Sequence; same for both SEQRES and ATOM records:

>d1y23c_ d.13.1.1 (C:) Hit {Bacillus subtilis [TaxId: 1423]}
encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
dykpedlqnisssiakrl

Timeline for d1y23c_:

• d1y23c_ first appeared in SCOP 1.71
  
• d1y23c_ appears in SCOPe 2.04
  
• d1y23c_ appears in SCOPe 2.06
  
• d1y23c_ appears in the current release, SCOPe 2.08