![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (3 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (6 proteins) Pfam 01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Hit [117789] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117790] (1 PDB entry) |
![]() | Domain d1y23c_: 1y23 C: [116396] |
PDB Entry: 1y23 (more details), 2.3 Å
SCOP Domain Sequences for d1y23c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y23c_ d.13.1.1 (C:) Hit {Bacillus subtilis} encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad dykpedlqnisssiakrl
Timeline for d1y23c_:
![]() Domains from other chains: (mouse over for more information) d1y23a_, d1y23b_, d1y23d_, d1y23e_ |