Lineage for d1y1xb_ (1y1x B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324637Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2324707Protein Programmed cell death 6 protein-like protein [116903] (1 species)
  7. 2324708Species Leishmania major [TaxId:5664] [116904] (1 PDB entry)
    Uniprot Q4QG08 53-234
  8. 2324710Domain d1y1xb_: 1y1x B: [116375]
    Structural genomics target
    complexed with ca, so4

Details for d1y1xb_

PDB Entry: 1y1x (more details), 1.95 Å

PDB Description: Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin
PDB Compounds: (B:) Leishmania Major Homolog of Programmed Cell Death 6 Protein

SCOPe Domain Sequences for d1y1xb_:

Sequence, based on SEQRES records: (download)

>d1y1xb_ a.39.1.8 (B:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}
tstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekllh
mydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseqt
fqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvsi
l

Sequence, based on observed residues (ATOM records): (download)

>d1y1xb_ a.39.1.8 (B:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}
tstgvyapsqelmewfravdtdgsgaisvpelnaalssagvpfslattekllhmydknhs
geitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseqtfqalmrk
fdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvsil

SCOPe Domain Coordinates for d1y1xb_:

Click to download the PDB-style file with coordinates for d1y1xb_.
(The format of our PDB-style files is described here.)

Timeline for d1y1xb_: