SCOPe 2.01: Domain d1y1wf_: 1y1w F:

Lineage for d1y1wf_ (1y1w F:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1y1wf_: 1y1w F: [116367]
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1y1wf_

PDB Entry: 1y1w, 4 Å

PDB Description: Complete RNA Polymerase II elongation complex

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1y1wf_:

Sequence; same for both SEQRES and ATOM records:

>d1y1wf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d1y1wf_:

• d1y1wf_ first appeared in SCOP 1.71
  
• d1y1wf_ appears in SCOP 1.75
  
• d1y1wf_ appears in SCOPe 2.02
  
• d1y1wf_ appears in the current release, SCOPe 2.08