SCOP 1.75: Domain d1y1vj_: 1y1v J:

Lineage for d1y1vj_ (1y1v J:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1y1vj_: 1y1v J: [116358]

Details for d1y1vj_

PDB Entry: 1y1v, 3.8 Å

PDB Description: refined rna polymerase ii-tfiis complex

PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOP Domain Sequences for d1y1vj_:

Sequence; same for both SEQRES and ATOM records:

>d1y1vj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1y1vj_:

• d1y1vj_ first appeared in SCOP 1.71
  
• d1y1vj_ appears in SCOP 1.73
  
• d1y1vj_ appears in SCOPe 2.01
  
• d1y1vj_ appears in the current release, SCOPe 2.08