Lineage for d1y1vi_ (1y1v I:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 628488Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 628489Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 628490Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 628491Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 628492Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (12 PDB entries)
  8. 628525Domain d1y1vi_: 1y1v I: [116357]

Details for d1y1vi_

PDB Entry: 1y1v (more details), 3.8 Å

PDB Description: refined rna polymerase ii-tfiis complex

SCOP Domain Sequences for d1y1vi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1vi_ i.8.1.1 (I:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvqd
igsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq

SCOP Domain Coordinates for d1y1vi_:

Click to download the PDB-style file with coordinates for d1y1vi_.
(The format of our PDB-style files is described here.)

Timeline for d1y1vi_: