Lineage for d1y1vf_ (1y1v F:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649260Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2649261Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2649262Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2649263Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2649264Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2649326Domain d1y1vf_: 1y1v F: [116354]
    protein/RNA complex; complexed with mg, zn

Details for d1y1vf_

PDB Entry: 1y1v (more details), 3.8 Å

PDB Description: refined rna polymerase ii-tfiis complex
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1y1vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1vf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d1y1vf_:

Click to download the PDB-style file with coordinates for d1y1vf_.
(The format of our PDB-style files is described here.)

Timeline for d1y1vf_: