Lineage for d1y1oc_ (1y1o C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 586152Family c.52.1.28: RecU-like [117631] (1 protein)
    Pfam 03838
  6. 586153Protein Recombination protein U (RecU)/PBP related factor A (PrfA) [117632] (2 species)
  7. 586154Species Bacillus stearothermophilus [TaxId:1422] [117634] (1 PDB entry)
  8. 586157Domain d1y1oc_: 1y1o C: [116347]

Details for d1y1oc_

PDB Entry: 1y1o (more details), 2.2 Å

PDB Description: X-ray crystal Structure of Penicillin-binding protein-related factor A from Bacillus stearothermophilus

SCOP Domain Sequences for d1y1oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1oc_ c.52.1.28 (C:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus stearothermophilus}
mtleddlnatneyyrergiavihkkptpvqivrvdypkrsaaviteayfrqasttdyngv
yrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrfsllnetylldas
hliawwnkqeaggrksipkqeierhghsiplgyqprldyisvvdnvyf

SCOP Domain Coordinates for d1y1oc_:

Click to download the PDB-style file with coordinates for d1y1oc_.
(The format of our PDB-style files is described here.)

Timeline for d1y1oc_: