Lineage for d1y1ld_ (1y1l D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874830Protein Arsenate reductase ArsC [69504] (3 species)
    also has a phosphotyrosine phosphatase activity
  7. 2874831Species Archaeoglobus fulgidus [TaxId:2234] [117577] (1 PDB entry)
    Uniprot O28910
  8. 2874835Domain d1y1ld_: 1y1l D: [116344]
    Structural genomics target
    complexed with cd

Details for d1y1ld_

PDB Entry: 1y1l (more details), 2.8 Å

PDB Description: crystal structure of arsenate reductase from archaeoglobus fulgidus dsm 4304, structural genomics
PDB Compounds: (D:) arsenate reductase (arsC)

SCOPe Domain Sequences for d1y1ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1ld_ c.44.1.1 (D:) Arsenate reductase ArsC {Archaeoglobus fulgidus [TaxId: 2234]}
kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
lvge

SCOPe Domain Coordinates for d1y1ld_:

Click to download the PDB-style file with coordinates for d1y1ld_.
(The format of our PDB-style files is described here.)

Timeline for d1y1ld_: