Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) share the common active site structure with the family II |
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins) |
Protein Arsenate reductase ArsC [69504] (3 species) also has a phosphotyrosine phosphatase activity |
Species Archaeoglobus fulgidus [TaxId:2234] [117577] (1 PDB entry) |
Domain d1y1lc_: 1y1l C: [116343] |
PDB Entry: 1y1l (more details), 2.8 Å
SCOP Domain Sequences for d1y1lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y1lc_ c.44.1.1 (C:) Arsenate reductase ArsC {Archaeoglobus fulgidus} kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk lvge
Timeline for d1y1lc_: