Lineage for d1y1lc_ (1y1l C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584193Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 584194Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 584195Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 584196Protein Arsenate reductase ArsC [69504] (3 species)
    also has a phosphotyrosine phosphatase activity
  7. 584197Species Archaeoglobus fulgidus [TaxId:2234] [117577] (1 PDB entry)
  8. 584200Domain d1y1lc_: 1y1l C: [116343]

Details for d1y1lc_

PDB Entry: 1y1l (more details), 2.8 Å

PDB Description: crystal structure of arsenate reductase from archaeoglobus fulgidus dsm 4304, structural genomics

SCOP Domain Sequences for d1y1lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1lc_ c.44.1.1 (C:) Arsenate reductase ArsC {Archaeoglobus fulgidus}
kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
lvge

SCOP Domain Coordinates for d1y1lc_:

Click to download the PDB-style file with coordinates for d1y1lc_.
(The format of our PDB-style files is described here.)

Timeline for d1y1lc_: