Lineage for d1y19h1 (1y19 H:209-308)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534842Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534857Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 534858Family a.11.2.1: Second domain of FERM [47032] (7 proteins)
  6. 534895Protein Talin-1 [116862] (1 species)
  7. 534896Species Mouse (Mus musculus) [TaxId:10090] [116863] (1 PDB entry)
  8. 534900Domain d1y19h1: 1y19 H:209-308 [116335]
    Other proteins in same PDB: d1y19b2, d1y19d2, d1y19f2, d1y19h2, d1y19j2, d1y19l2

Details for d1y19h1

PDB Entry: 1y19 (more details), 2.6 Å

PDB Description: structural basis for phosphatidylinositol phosphate kinase type i- gamma binding to talin at focal adhesions

SCOP Domain Sequences for d1y19h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y19h1 a.11.2.1 (H:209-308) Talin-1 {Mouse (Mus musculus)}
pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
eyvkqkgerkifqahkncgqmseieakvryvklarslkty

SCOP Domain Coordinates for d1y19h1:

Click to download the PDB-style file with coordinates for d1y19h1.
(The format of our PDB-style files is described here.)

Timeline for d1y19h1: