Lineage for d1y14d2 (1y14 D:1-80)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240281Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2240282Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) (S)
    automatically mapped to Pfam PF03876
  5. 2240283Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)
  6. 2240284Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)
  7. 2240285Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)
    Uniprot P34087
  8. 2240287Domain d1y14d2: 1y14 D:1-80 [116327]
    Other proteins in same PDB: d1y14a_, d1y14b1, d1y14c_, d1y14d1

Details for d1y14d2

PDB Entry: 1y14 (more details), 2.3 Å

PDB Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7
PDB Compounds: (D:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d1y14d2:

Sequence, based on SEQRES records: (download)

>d1y14d2 d.230.1.1 (D:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

Sequence, based on observed residues (ATOM records): (download)

>d1y14d2 d.230.1.1 (D:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqaefn
vkyravvfk

SCOPe Domain Coordinates for d1y14d2:

Click to download the PDB-style file with coordinates for d1y14d2.
(The format of our PDB-style files is described here.)

Timeline for d1y14d2: