Lineage for d1y14b1 (1y14 B:81-171)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541517Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
  7. 1541518Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
    Uniprot P34087
  8. 1541519Domain d1y14b1: 1y14 B:81-171 [116323]
    Other proteins in same PDB: d1y14a_, d1y14b2, d1y14c_, d1y14d2

Details for d1y14b1

PDB Entry: 1y14 (more details), 2.3 Å

PDB Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7
PDB Compounds: (B:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d1y14b1:

Sequence, based on SEQRES records: (download)

>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

Sequence, based on observed residues (ATOM records): (download)

>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnasyqssedvitiksrirv
kiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d1y14b1:

Click to download the PDB-style file with coordinates for d1y14b1.
(The format of our PDB-style files is described here.)

Timeline for d1y14b1: