![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 proteins) Pfam PF03322 |
![]() | Protein Clavaminate synthase-like protein At3g21360 [117321] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117322] (1 PDB entry) Uniprot Q9LIG0 |
![]() | Domain d1y0za_: 1y0z A: [116317] Structural genomics target complexed with fe2, so4 |
PDB Entry: 1y0z (more details), 2.4 Å
SCOPe Domain Sequences for d1y0za_:
Sequence, based on SEQRES records: (download)
>d1y0za_ b.82.2.8 (A:) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesga vlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhem aqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlge dddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrn rkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdv llidnwavlhsrrpfdpprrvlaslck
>d1y0za_ b.82.2.8 (A:) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lllvetpipqqkhyeskpfpavispppalslplftqtiktqkhyldsllhesgavlfrgf pvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhemaqvref psklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpss pigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwfn smvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidnw avlhsrrpfdpprrvlaslck
Timeline for d1y0za_: