Lineage for d1y0za_ (1y0z A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071004Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 protein domains)
    Pfam PF03322
  6. 2071017Protein Clavaminate synthase-like protein At3g21360 [117321] (1 species)
  7. 2071018Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117322] (1 PDB entry)
    Uniprot Q9LIG0
  8. 2071019Domain d1y0za_: 1y0z A: [116317]
    Structural genomics target
    complexed with fe2, so4

Details for d1y0za_

PDB Entry: 1y0z (more details), 2.4 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g21360
PDB Compounds: (A:) protein product of AT3G21360

SCOPe Domain Sequences for d1y0za_:

Sequence, based on SEQRES records: (download)

>d1y0za_ b.82.2.8 (A:) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesga
vlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhem
aqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlge
dddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrn
rkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdv
llidnwavlhsrrpfdpprrvlaslck

Sequence, based on observed residues (ATOM records): (download)

>d1y0za_ b.82.2.8 (A:) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lllvetpipqqkhyeskpfpavispppalslplftqtiktqkhyldsllhesgavlfrgf
pvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhemaqvref
psklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpss
pigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwfn
smvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidnw
avlhsrrpfdpprrvlaslck

SCOPe Domain Coordinates for d1y0za_:

Click to download the PDB-style file with coordinates for d1y0za_.
(The format of our PDB-style files is described here.)

Timeline for d1y0za_: