Lineage for d1y0xx_ (1y0x X:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543722Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 543723Species Human (Homo sapiens) [TaxId:9606] [48531] (10 PDB entries)
  8. 543732Domain d1y0xx_: 1y0x X: [116316]
    complexed with cac, t44

Details for d1y0xx_

PDB Entry: 1y0x (more details), 3.1 Å

PDB Description: thyroxine-thyroid hormone receptor interactions

SCOP Domain Sequences for d1y0xx_:

Sequence, based on SEQRES records: (download)

>d1y0xx_ a.123.1.1 (X:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
shmeelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivna
peggkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraa
vrydpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavll
mssdrpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasr
flhmkvecptelfpplflevfe

Sequence, based on observed residues (ATOM records): (download)

>d1y0xx_ a.123.1.1 (X:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
shmeelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfe

SCOP Domain Coordinates for d1y0xx_:

Click to download the PDB-style file with coordinates for d1y0xx_.
(The format of our PDB-style files is described here.)

Timeline for d1y0xx_: