Lineage for d1y0xx1 (1y0x X:202-460)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48531] (21 PDB entries)
    Uniprot P10828 202-460
  8. Domain d1y0xx1: 1y0x X:202-460 [116316]
    Other proteins in same PDB: d1y0xx2
    complexed with cac, t44

Details for d1y0xx1

PDB Entry: 1y0x (more details), 3.1 Å

PDB Description: thyroxine-thyroid hormone receptor interactions
PDB Compounds: (X:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d1y0xx1:

Sequence, based on SEQRES records: (download)

>d1y0xx1 a.123.1.1 (X:202-460) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
eelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeg
gkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavry
dpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmss
drpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflh
mkvecptelfpplflevfe

Sequence, based on observed residues (ATOM records): (download)

>d1y0xx1 a.123.1.1 (X:202-460) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
eelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigvdleafshft
kiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlnge
mavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacverie
kyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpp
lflevfe

SCOPe Domain Coordinates for d1y0xx1 are not available.

Timeline for d1y0xx1:

Domains from same chain:
(mouse over for more information)
d1y0xx2