![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (24 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (177 PDB entries) Uniprot P68871 |
![]() | Domain d1y0wd_: 1y0w D: [116315] Other proteins in same PDB: d1y0wa_, d1y0wc_ complexed with hem; mutant |
PDB Entry: 1y0w (more details), 2.14 Å
SCOP Domain Sequences for d1y0wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0wd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1y0wd_: