SCOPe 2.06: Domain d1y0ua1: 1y0u A:1-87

Lineage for d1y0ua1 (1y0u A:1-87)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Putative arsenical resistance operon repressor AF0168 [116786] (1 species)
   lacks the extra C-terminal helix

7. Species Archaeoglobus fulgidus [TaxId:2234] [116787] (1 PDB entry)
   Uniprot O30069

8. Domain d1y0ua1: 1y0u A:1-87 [116310]
   Other proteins in same PDB: d1y0ua2, d1y0ub2
   Structural genomics target
   complexed with act

Details for d1y0ua1

PDB Entry: 1y0u, 1.6 Å

PDB Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus

PDB Compounds: (A:) arsenical resistance operon repressor, putative

SCOPe Domain Sequences for d1y0ua1:

Sequence; same for both SEQRES and ATOM records:

>d1y0ua1 a.4.5.5 (A:1-87) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]}
msleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkqldy
hlkvleagfciervgerwvvtdagkiv

Timeline for d1y0ua1:

• d1y0ua1 first appeared in SCOP 1.71, called d1y0ua_
  
• d1y0ua1 was called d1y0ua_ in SCOPe 2.05
  
• d1y0ua1 appears in SCOPe 2.07
  
• d1y0ua1 appears in the current release, SCOPe 2.08