Lineage for d1y0na1 (1y0n A:1-76)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242057Fold d.291: YehU-like [118000] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 3 layers, alpha/beta/alpha; antiparallel beta-sheet: order 123
  4. 2242058Superfamily d.291.1: YehU-like [118001] (1 family) (S)
    automatically mapped to Pfam PF06794
  5. 2242059Family d.291.1.1: YehU-like [118002] (1 protein)
    Pfam PF06794; UPF0270
  6. 2242060Protein Hypothetical UPF0270 protein PA3463 [118003] (1 species)
  7. 2242061Species Pseudomonas aeruginosa [TaxId:287] [118004] (1 PDB entry)
    Uniprot Q9HYE3
  8. 2242062Domain d1y0na1: 1y0n A:1-76 [116305]
    Other proteins in same PDB: d1y0na2
    Structural genomics target
    complexed with gol

Details for d1y0na1

PDB Entry: 1y0n (more details), 2 Å

PDB Description: Structure of Protein of Unknown Function PA3463 from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Hypothetical UPF0270 protein PA3463

SCOPe Domain Sequences for d1y0na1:

Sequence, based on SEQRES records: (download)

>d1y0na1 d.291.1.1 (A:1-76) Hypothetical UPF0270 protein PA3463 {Pseudomonas aeruginosa [TaxId: 287]}
mliphdlleadtlnnlledfvtregtdngdetpldvrverarhalrrgeavilfdpesqq
cqlmlrsevpaellrd

Sequence, based on observed residues (ATOM records): (download)

>d1y0na1 d.291.1.1 (A:1-76) Hypothetical UPF0270 protein PA3463 {Pseudomonas aeruginosa [TaxId: 287]}
mliphdlleadtlnnlledfvtretpldvrverarhalrrgeavilfdpesqqcqlmlrs
evpaellrd

SCOPe Domain Coordinates for d1y0na1:

Click to download the PDB-style file with coordinates for d1y0na1.
(The format of our PDB-style files is described here.)

Timeline for d1y0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y0na2