Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.291: YehU-like [118000] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 3 layers, alpha/beta/alpha; antiparallel beta-sheet: order 123 |
Superfamily d.291.1: YehU-like [118001] (1 family) automatically mapped to Pfam PF06794 |
Family d.291.1.1: YehU-like [118002] (1 protein) Pfam PF06794; UPF0270 |
Protein Hypothetical UPF0270 protein PA3463 [118003] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [118004] (1 PDB entry) Uniprot Q9HYE3 |
Domain d1y0na1: 1y0n A:1-76 [116305] Other proteins in same PDB: d1y0na2 Structural genomics target complexed with gol |
PDB Entry: 1y0n (more details), 2 Å
SCOPe Domain Sequences for d1y0na1:
Sequence, based on SEQRES records: (download)
>d1y0na1 d.291.1.1 (A:1-76) Hypothetical UPF0270 protein PA3463 {Pseudomonas aeruginosa [TaxId: 287]} mliphdlleadtlnnlledfvtregtdngdetpldvrverarhalrrgeavilfdpesqq cqlmlrsevpaellrd
>d1y0na1 d.291.1.1 (A:1-76) Hypothetical UPF0270 protein PA3463 {Pseudomonas aeruginosa [TaxId: 287]} mliphdlleadtlnnlledfvtretpldvrverarhalrrgeavilfdpesqqcqlmlrs evpaellrd
Timeline for d1y0na1: