Lineage for d1y0hb_ (1y0h B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907024Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 1907046Protein Hypothetical protein Rv0793 [117938] (1 species)
  7. 1907047Species Mycobacterium tuberculosis [TaxId:1773] [117939] (1 PDB entry)
    Uniprot O86332
  8. 1907049Domain d1y0hb_: 1y0h B: [116304]
    Structural genomics target
    complexed with act

Details for d1y0hb_

PDB Entry: 1y0h (more details), 1.6 Å

PDB Description: structure of rv0793 from mycobacterium tuberculosis
PDB Compounds: (B:) hypothetical protein Rv0793

SCOPe Domain Sequences for d1y0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0hb_ d.58.4.11 (B:) Hypothetical protein Rv0793 {Mycobacterium tuberculosis [TaxId: 1773]}
spvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyrsri
aldehrgsphylnyraqvgelltrpvavtvlapldeas

SCOPe Domain Coordinates for d1y0hb_:

Click to download the PDB-style file with coordinates for d1y0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1y0hb_: