SCOP 1.73: Domain d1y0hb_: 1y0h B:

Lineage for d1y0hb_ (1y0h B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (3 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein Rv0793 [117938] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117939] (1 PDB entry)

8. Domain d1y0hb_: 1y0h B: [116304]
   Structural genomics target
   complexed with act

Details for d1y0hb_

PDB Entry: 1y0h, 1.6 Å

PDB Description: structure of rv0793 from mycobacterium tuberculosis

PDB Compounds: (B:) hypothetical protein Rv0793

SCOP Domain Sequences for d1y0hb_:

Sequence; same for both SEQRES and ATOM records:

>d1y0hb_ d.58.4.11 (B:) Hypothetical protein Rv0793 {Mycobacterium tuberculosis [TaxId: 1773]}
spvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyrsri
aldehrgsphylnyraqvgelltrpvavtvlapldeas

Timeline for d1y0hb_:

• d1y0hb_ first appeared in SCOP 1.71
  
• d1y0hb_ appears in SCOP 1.75
  
• d1y0hb_ appears in the current release, SCOPe 2.08