Lineage for d1y0ha_ (1y0h A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556782Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 2556804Protein Hypothetical protein Rv0793 [117938] (1 species)
  7. 2556805Species Mycobacterium tuberculosis [TaxId:1773] [117939] (1 PDB entry)
    Uniprot O86332
  8. 2556806Domain d1y0ha_: 1y0h A: [116303]
    Structural genomics target
    complexed with act

Details for d1y0ha_

PDB Entry: 1y0h (more details), 1.6 Å

PDB Description: structure of rv0793 from mycobacterium tuberculosis
PDB Compounds: (A:) hypothetical protein Rv0793

SCOPe Domain Sequences for d1y0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ha_ d.58.4.11 (A:) Hypothetical protein Rv0793 {Mycobacterium tuberculosis [TaxId: 1773]}
gmtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyr
srialdehrgsphylnyraqvgelltrpvavtvlapldeas

SCOPe Domain Coordinates for d1y0ha_:

Click to download the PDB-style file with coordinates for d1y0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1y0ha_: