![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein Rv0793 [117938] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117939] (1 PDB entry) Uniprot O86332 |
![]() | Domain d1y0ha_: 1y0h A: [116303] Structural genomics target complexed with act |
PDB Entry: 1y0h (more details), 1.6 Å
SCOPe Domain Sequences for d1y0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ha_ d.58.4.11 (A:) Hypothetical protein Rv0793 {Mycobacterium tuberculosis [TaxId: 1773]} gmtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyr srialdehrgsphylnyraqvgelltrpvavtvlapldeas
Timeline for d1y0ha_: