Lineage for d1y0gc_ (1y0g C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674466Superfamily b.61.6: YceI-like [101874] (1 family) (S)
  5. 674467Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam PF04264
  6. 674468Protein Lipid binding protein YceI [117267] (1 species)
  7. 674469Species Escherichia coli [TaxId:562] [117268] (1 PDB entry)
  8. 674472Domain d1y0gc_: 1y0g C: [116301]

Details for d1y0gc_

PDB Entry: 1y0g (more details), 2.2 Å

PDB Description: crystal structure of the escherichia coli ycei protein, structural genomics
PDB Compounds: (C:) Protein yceI

SCOP Domain Sequences for d1y0gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0gc_ b.61.6.1 (C:) Lipid binding protein YceI {Escherichia coli [TaxId: 562]}
adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk

SCOP Domain Coordinates for d1y0gc_:

Click to download the PDB-style file with coordinates for d1y0gc_.
(The format of our PDB-style files is described here.)

Timeline for d1y0gc_: