Lineage for d1y0gb_ (1y0g B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564717Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 565049Superfamily b.61.6: YceI-like [101874] (1 family) (S)
  5. 565050Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam 04264
  6. 565051Protein Lipid binding protein YceI [117267] (1 species)
  7. 565052Species Escherichia coli [TaxId:562] [117268] (1 PDB entry)
  8. 565054Domain d1y0gb_: 1y0g B: [116300]

Details for d1y0gb_

PDB Entry: 1y0g (more details), 2.2 Å

PDB Description: crystal structure of the escherichia coli ycei protein, structural genomics

SCOP Domain Sequences for d1y0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0gb_ b.61.6.1 (B:) Lipid binding protein YceI {Escherichia coli}
adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk

SCOP Domain Coordinates for d1y0gb_:

Click to download the PDB-style file with coordinates for d1y0gb_.
(The format of our PDB-style files is described here.)

Timeline for d1y0gb_: