Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.6: YceI-like [101874] (2 families) |
Family b.61.6.1: YceI-like [101875] (2 proteins) Pfam PF04264 |
Protein Lipid binding protein YceI [117267] (1 species) |
Species Escherichia coli [TaxId:562] [117268] (1 PDB entry) Uniprot P0A8X2 |
Domain d1y0ga_: 1y0g A: [116299] Structural genomics target complexed with 8pp |
PDB Entry: 1y0g (more details), 2.2 Å
SCOPe Domain Sequences for d1y0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ga_ b.61.6.1 (A:) Lipid binding protein YceI {Escherichia coli [TaxId: 562]} adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk
Timeline for d1y0ga_: