Lineage for d1y0ga_ (1y0g A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806605Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2806606Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam PF04264
  6. 2806607Protein Lipid binding protein YceI [117267] (1 species)
  7. 2806608Species Escherichia coli [TaxId:562] [117268] (1 PDB entry)
    Uniprot P0A8X2
  8. 2806609Domain d1y0ga_: 1y0g A: [116299]
    Structural genomics target
    complexed with 8pp

Details for d1y0ga_

PDB Entry: 1y0g (more details), 2.2 Å

PDB Description: crystal structure of the escherichia coli ycei protein, structural genomics
PDB Compounds: (A:) Protein yceI

SCOPe Domain Sequences for d1y0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ga_ b.61.6.1 (A:) Lipid binding protein YceI {Escherichia coli [TaxId: 562]}
adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk

SCOPe Domain Coordinates for d1y0ga_:

Click to download the PDB-style file with coordinates for d1y0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1y0ga_: