SCOP 1.71: Domain d1y0eb_: 1y0e B:

Lineage for d1y0eb_ (1y0e B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam 04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [117364] (1 PDB entry)

8. Domain d1y0eb_: 1y0e B: [116298]
   Structural genomics target
   complexed with po4; mutant

Details for d1y0eb_

PDB Entry: 1y0e, 1.95 Å

PDB Description: crystal structure of putative mannac-6-p epimerase from staphylococcus aureus (strain n315)

SCOP Domain Sequences for d1y0eb_:

Sequence; same for both SEQRES and ATOM records:

>d1y0eb_ c.1.2.5 (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus}
amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme

Timeline for d1y0eb_:

• d1y0eb_ is new in SCOP 1.71
  
• d1y0eb_ appears in SCOP 1.73
  
• d1y0eb_ appears in the current release, SCOPe 2.08, called d1y0eb1