SCOPe 2.05: Domain d1y0ea_: 1y0e A:

Lineage for d1y0ea_ (1y0e A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam PF04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [117364] (1 PDB entry)
   Uniprot P65517

8. Domain d1y0ea_: 1y0e A: [116297]
   Structural genomics target
   complexed with po4

Details for d1y0ea_

PDB Entry: 1y0e, 1.95 Å

PDB Description: crystal structure of putative mannac-6-p epimerase from staphylococcus aureus (strain n315)

PDB Compounds: (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d1y0ea_:

Sequence; same for both SEQRES and ATOM records:

>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]}
amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme

Timeline for d1y0ea_:

• d1y0ea_ first appeared in SCOP 1.71
  
• d1y0ea_ appears in SCOPe 2.04
  
• d1y0ea_ is called d1y0ea1 in SCOPe 2.06
  
• d1y0ea_ appears in the current release, SCOPe 2.08, called d1y0ea1