![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.5: NanE-like [117362] (1 protein) Pfam PF04131 |
![]() | Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [117364] (1 PDB entry) Uniprot P65517 |
![]() | Domain d1y0ea1: 1y0e A:1-221 [116297] Other proteins in same PDB: d1y0ea2, d1y0eb2 Structural genomics target complexed with po4 |
PDB Entry: 1y0e (more details), 1.95 Å
SCOPe Domain Sequences for d1y0ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ea1 c.1.2.5 (A:1-221) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} mlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvig ivkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnve imadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakviae gnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme
Timeline for d1y0ea1: