![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins) automatically mapped to Pfam PF09028 |
![]() | Protein IgG-specific endopeptidase IdeS (Sib38) [117763] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [117764] (2 PDB entries) Uniprot Q9F1R7 38-339 # SPy0861 |
![]() | Domain d1y08a_: 1y08 A: [116280] complexed with so4 |
PDB Entry: 1y08 (more details), 1.93 Å
SCOPe Domain Sequences for d1y08a_:
Sequence, based on SEQRES records: (download)
>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]} tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstkh lgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfk eknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsdsn asigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn
>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]} tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylkhlg vfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfkek nlkeisdlikkeltegkalglshtyrinhvinlwgadfdsngnlkaiyvtdsdsnasigm kkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn
Timeline for d1y08a_: