Lineage for d1y08a_ (1y08 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597350Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (1 protein)
  6. 597351Protein IgG-specific endopeptidase IdeS (Sib38) [117763] (1 species)
  7. 597352Species Streptococcus pyogenes [TaxId:1314] [117764] (1 PDB entry)
  8. 597353Domain d1y08a_: 1y08 A: [116280]
    complexed with so4; mutant

Details for d1y08a_

PDB Entry: 1y08 (more details), 1.93 Å

PDB Description: structure of the streptococcal endopeptidase ides, a novel cysteine proteinase with strict specificity for igg

SCOP Domain Sequences for d1y08a_:

Sequence, based on SEQRES records: (download)

>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes}
tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstkh
lgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfk
eknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsdsn
asigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn

Sequence, based on observed residues (ATOM records): (download)

>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes}
tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylkhlg
vfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfkek
nlkeisdlikkeltegkalglshtyrinhvinlwgadfdsngnlkaiyvtdsdsnasigm
kkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn

SCOP Domain Coordinates for d1y08a_:

Click to download the PDB-style file with coordinates for d1y08a_.
(The format of our PDB-style files is described here.)

Timeline for d1y08a_: