Lineage for d1y01a_ (1y01 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636851Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, scop_sf 55194
  5. 636852Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
  6. 636853Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 636854Species Human (Homo sapiens) [TaxId:9606] [109754] (6 PDB entries)
  8. 636857Domain d1y01a_: 1y01 A: [116276]
    Other proteins in same PDB: d1y01b_
    complexed with chk, hem, o2; mutant

Details for d1y01a_

PDB Entry: 1y01 (more details), 2.8 Å

PDB Description: Crystal structure of AHSP bound to Fe(II) alpha-hemoglobin
PDB Compounds: (A:) alpha-hemoglobin stabilizing protein

SCOP Domain Sequences for d1y01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y01a_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
llkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgepqe
rdkalqelrqelntlanpflakyrdflks

SCOP Domain Coordinates for d1y01a_:

Click to download the PDB-style file with coordinates for d1y01a_.
(The format of our PDB-style files is described here.)

Timeline for d1y01a_: