![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (13 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) ![]() the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, scop_sf 55194 |
![]() | Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein) this is a repeat family; one repeat unit is 1w0a A: found in domain |
![]() | Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109754] (5 PDB entries) |
![]() | Domain d1y01a_: 1y01 A: [116276] Other proteins in same PDB: d1y01b_ complexed with chk, hem, o2; mutant |
PDB Entry: 1y01 (more details), 2.8 Å
SCOP Domain Sequences for d1y01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y01a_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens)} llkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgepqe rdkalqelrqelntlanpflakyrdflks
Timeline for d1y01a_: