Lineage for d1xzya_ (1xzy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310203Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)
    automatically mapped to Pfam PF09236
  5. 2310204Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
    this is a repeat family; one repeat unit is 1w0a A: found in domain
  6. 2310205Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 2310206Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries)
    Uniprot Q9NZD4 1-94
  8. 2310213Domain d1xzya_: 1xzy A: [116275]

Details for d1xzya_

PDB Entry: 1xzy (more details)

PDB Description: solution structure of the p30-trans form of alpha hemoglobin stabilizing protein (ahsp)
PDB Compounds: (A:) alpha-hemoglobin stabilizing protein

SCOPe Domain Sequences for d1xzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzya_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
mallkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgep
qerdkalqelrqelntlanpflakyrdflk

SCOPe Domain Coordinates for d1xzya_:

Click to download the PDB-style file with coordinates for d1xzya_.
(The format of our PDB-style files is described here.)

Timeline for d1xzya_: