Lineage for d1xzwb2 (1xzw B:620-926)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224837Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1224838Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1224839Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1224846Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species)
    also contain an Ig-like domain
  7. 1224866Species Sweet potato (Ipomoea batatas) [TaxId:4120] [118151] (1 PDB entry)
    Uniprot Q9SE00 39-462
  8. 1224868Domain d1xzwb2: 1xzw B:620-926 [116273]
    Other proteins in same PDB: d1xzwa1, d1xzwb3
    complexed with fe, mn, nag, po4

Details for d1xzwb2

PDB Entry: 1xzw (more details), 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d1xzwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzwb2 d.159.1.1 (B:620-926) Plant purple acid phosphatase, catalytic domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
kpgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwd
twgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyai
krasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymeg
eamraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitig
dggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwl
lnrywas

SCOPe Domain Coordinates for d1xzwb2:

Click to download the PDB-style file with coordinates for d1xzwb2.
(The format of our PDB-style files is described here.)

Timeline for d1xzwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xzwb3