Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (2 proteins) |
Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
Species Sweet potato (Ipomoea batatas) [TaxId:4120] [118151] (1 PDB entry) Uniprot Q9SE00 39-462 |
Domain d1xzwb2: 1xzw B:620-926 [116273] Other proteins in same PDB: d1xzwa1, d1xzwb3 complexed with fe, fuc, man, mn, nag, po4 |
PDB Entry: 1xzw (more details), 2.5 Å
SCOP Domain Sequences for d1xzwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzwb2 d.159.1.1 (B:620-926) Plant purple acid phosphatase, catalytic domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} kpgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwd twgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyai krasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymeg eamraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitig dggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwl lnrywas
Timeline for d1xzwb2: