SCOP 1.75: Domain d1xzwb2: 1xzw B:620-926

Lineage for d1xzwb2 (1xzw B:620-926)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (2 proteins)

6. Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species)
   also contain an Ig-like domain

7. Species Sweet potato (Ipomoea batatas) [TaxId:4120] [118151] (1 PDB entry)
   Uniprot Q9SE00 39-462

8. Domain d1xzwb2: 1xzw B:620-926 [116273]
   Other proteins in same PDB: d1xzwa1, d1xzwb3
   complexed with fe, fuc, man, mn, nag, po4

Details for d1xzwb2

PDB Entry: 1xzw, 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex

PDB Compounds: (B:) purple acid phosphatase

SCOP Domain Sequences for d1xzwb2:

Sequence; same for both SEQRES and ATOM records:

>d1xzwb2 d.159.1.1 (B:620-926) Plant purple acid phosphatase, catalytic domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
kpgpdvpyvfgligdigqthdsnttlthyeqnsakgqavlfmgdlsysnrwpnhdnnrwd
twgrfsersvayqpwiwtagnheidyapdigeyqpfvpftnryptpheasgsgdplwyai
krasahiivlssysgfvkyspqykwftselekvnrsetpwlivlvhaplynsyeahymeg
eamraifepyfvyykvdivfsghvhsyerservsnvaynivnakctpvsdesapvyitig
dggnseglasemtqpqpsysafreasfghgifdiknrthahfswhrnqdgasveadslwl
lnrywas

Timeline for d1xzwb2:

• d1xzwb2 first appeared in SCOP 1.71
  
• d1xzwb2 appears in SCOP 1.73
  
• d1xzwb2 appears in SCOPe 2.01
  
• d1xzwb2 appears in the current release, SCOPe 2.08