SCOP 1.75: Domain d1xzwa1: 1xzw A:1-119

Lineage for d1xzwa1 (1xzw A:1-119)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)

7. Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry)
   Uniprot Q9SE00 39-462

8. Domain d1xzwa1: 1xzw A:1-119 [116270]
   Other proteins in same PDB: d1xzwa2, d1xzwb2

Details for d1xzwa1

PDB Entry: 1xzw, 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex

PDB Compounds: (A:) purple acid phosphatase

SCOP Domain Sequences for d1xzwa1:

Sequence; same for both SEQRES and ATOM records:

>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp

Timeline for d1xzwa1:

• d1xzwa1 first appeared in SCOP 1.71
  
• d1xzwa1 appears in SCOP 1.73
  
• d1xzwa1 appears in SCOPe 2.01
  
• d1xzwa1 appears in the current release, SCOPe 2.08