| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (19 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries) |
| Domain d1xzuc_: 1xzu C: [116264] Other proteins in same PDB: d1xzub_, d1xzud_ complexed with hem; mutant |
PDB Entry: 1xzu (more details), 2.16 Å
SCOP Domain Sequences for d1xzuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzuc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvgpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr
Timeline for d1xzuc_: