![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
![]() | Superfamily d.250.1: Folate-binding domain [103025] (2 families) ![]() some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
![]() | Family d.250.1.2: TrmE formyl-THF-binding domain [117997] (1 protein) dimeric biological unit; one subunit domain corresponds to one "unswapped" subdomain of the other family |
![]() | Protein TrmE formyl-THF-binding domain [117998] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117999] (2 PDB entries) |
![]() | Domain d1xzqb1: 1xzq B:1-117 [116261] Other proteins in same PDB: d1xzqa1, d1xzqa2 complexed with fon |
PDB Entry: 1xzq (more details), 2.9 Å
SCOP Domain Sequences for d1xzqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzqb1 d.250.1.2 (B:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} mdtivavatppgkgaiailrlsgpdswkivqkhlrtrskivprkaihgwihengedvdev vvvfykspksytgedmvevmchggplvvkklldlflksgarmaepgeftkraflngk
Timeline for d1xzqb1: