SCOPe 2.07: Domain d1xzqa2: 1xzq A:212-371

Lineage for d1xzqa2 (1xzq A:212-371)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein TrmE GTPase domain [117535] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117536] (2 PDB entries)
   Uniprot Q9WYA4

8. Domain d1xzqa2: 1xzq A:212-371 [116259]
   Other proteins in same PDB: d1xzqa1, d1xzqa3, d1xzqb1
   protein/RNA complex; complexed with fon

Details for d1xzqa2

PDB Entry: 1xzq, 2.9 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima complexed with 5-formyl-THF

PDB Compounds: (A:) Probable tRNA modification GTPase trmE

SCOPe Domain Sequences for d1xzqa2:

Sequence; same for both SEQRES and ATOM records:

>d1xzqa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}
lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs
etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv
ekineeeiknklgtdrhmvkisalkgeglekleesiyret

Timeline for d1xzqa2:

• d1xzqa2 first appeared in SCOP 1.71
  
• d1xzqa2 appears in SCOPe 2.06
  
• d1xzqa2 appears in the current release, SCOPe 2.08