SCOP 1.71: Domain d1xzqa2: 1xzq A:212-371

Lineage for d1xzqa2 (1xzq A:212-371)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein TrmE GTPase domain [117535] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [117536] (2 PDB entries)

8. Domain d1xzqa2: 1xzq A:212-371 [116259]
   Other proteins in same PDB: d1xzqa1, d1xzqa3, d1xzqb1
   complexed with fon

Details for d1xzqa2

PDB Entry: 1xzq, 2.9 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima complexed with 5-formyl-THF

SCOP Domain Sequences for d1xzqa2:

Sequence; same for both SEQRES and ATOM records:

>d1xzqa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima}
lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs
etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv
ekineeeiknklgtdrhmvkisalkgeglekleesiyret

Timeline for d1xzqa2:

• d1xzqa2 is new in SCOP 1.71
  
• d1xzqa2 appears in SCOP 1.73
  
• d1xzqa2 appears in the current release, SCOPe 2.08