Lineage for d1xzqa2 (1xzq A:212-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867970Protein TrmE GTPase domain [117535] (1 species)
  7. 2867971Species Thermotoga maritima [TaxId:2336] [117536] (2 PDB entries)
    Uniprot Q9WYA4
  8. 2867973Domain d1xzqa2: 1xzq A:212-371 [116259]
    Other proteins in same PDB: d1xzqa1, d1xzqa3, d1xzqb1
    protein/RNA complex; complexed with fon

Details for d1xzqa2

PDB Entry: 1xzq (more details), 2.9 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima complexed with 5-formyl-THF
PDB Compounds: (A:) Probable tRNA modification GTPase trmE

SCOPe Domain Sequences for d1xzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzqa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}
lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs
etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv
ekineeeiknklgtdrhmvkisalkgeglekleesiyret

SCOPe Domain Coordinates for d1xzqa2:

Click to download the PDB-style file with coordinates for d1xzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1xzqa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xzqb1