Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.25: TrmE connector domain [116878] (1 family) |
Family a.24.25.1: TrmE connector domain [116879] (1 protein) |
Protein TrmE connector domain [116880] (1 species) |
Species Thermotoga maritima [TaxId:2336] [116881] (2 PDB entries) Uniprot Q9WYA4 |
Domain d1xzqa1: 1xzq A:118-211,A:372-450 [116258] Other proteins in same PDB: d1xzqa2, d1xzqa3, d1xzqb1 protein/RNA complex; complexed with fon |
PDB Entry: 1xzq (more details), 2.9 Å
SCOPe Domain Sequences for d1xzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzqa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]} mdltsaeavrdlieaksetslklslrnlkgglrdfvdslrrelievlaeirveldypdei etntgevvtrlerikeklteelkkadagillnrgXqeifergsdslitnlrqkqllenvk ghledaikslkegmpvdmasidleralnlldevtgrsfredlldtifsnfcvgk
Timeline for d1xzqa1: