Lineage for d1xzqa1 (1xzq A:118-211,A:372-450)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1084122Superfamily a.24.25: TrmE connector domain [116878] (1 family) (S)
  5. 1084123Family a.24.25.1: TrmE connector domain [116879] (1 protein)
  6. 1084124Protein TrmE connector domain [116880] (1 species)
  7. 1084125Species Thermotoga maritima [TaxId:2336] [116881] (2 PDB entries)
    Uniprot Q9WYA4
  8. 1084127Domain d1xzqa1: 1xzq A:118-211,A:372-450 [116258]
    Other proteins in same PDB: d1xzqa2, d1xzqa3, d1xzqb1
    protein/RNA complex; complexed with fon

Details for d1xzqa1

PDB Entry: 1xzq (more details), 2.9 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima complexed with 5-formyl-THF
PDB Compounds: (A:) Probable tRNA modification GTPase trmE

SCOPe Domain Sequences for d1xzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzqa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]}
mdltsaeavrdlieaksetslklslrnlkgglrdfvdslrrelievlaeirveldypdei
etntgevvtrlerikeklteelkkadagillnrgXqeifergsdslitnlrqkqllenvk
ghledaikslkegmpvdmasidleralnlldevtgrsfredlldtifsnfcvgk

SCOPe Domain Coordinates for d1xzqa1:

Click to download the PDB-style file with coordinates for d1xzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1xzqa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xzqb1